PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_121533g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 415aa    MW: 45311.2 Da    PI: 5.1482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_121533g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l++ v+++G+g +W + +r+ g++R++k+c++rw++yl
   MA_121533g0010 14 RGPWSPEEDTILKNFVEKHGTGgNWIALPRKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding39.71.1e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
   MA_121533g0010  69 GDFSEEEDSIICSLYTSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.678962IPR017930Myb domain
SuperFamilySSF466891.41E-2711109IPR009057Homeodomain-like
SMARTSM007178.7E-131364IPR001005SANT/Myb domain
PfamPF002491.6E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231569IPR009057Homeodomain-like
CDDcd001678.59E-101662No hitNo description
PROSITE profilePS5129422.34563117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2370117IPR009057Homeodomain-like
CDDcd001671.10E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDTILKNFVE KHGTGGNWIA LPRKAGLKRC GKSCRLRWLN  60
YLRPDIKHGD FSEEEDSIIC SLYTSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
CTKDNDNQQI RRLLAKEAAK GAGIRRPYNG DHISSETAAM SASNTQSSSE SLTEPATGAN  180
AMNSPYDALE TGNVPGSTSS ESQTVGFNAT HGTNTHYYEQ GFKQIMSQTD QYSTLTSMLM  240
RLESNESDCS TDNIPSLGID TIPNEVPFYA PTAMNVKAEA MERPSSDPQL NQACNSMPAL  300
WESCTSNSTS GGNNYQFSTL MNEDTGNFSY GLSAEMDELI LYRNHASNGS ILQVKEEPDY  360
STAAAYWASQ LAEPAKASGF TATICPNYSY ILPSSEGGIG TGTTAQGLFQ EGIIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1154860.0BT115486.1 Picea glauca clone GQ03617_M11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FKL21e-75MYB36_ARATH; Transcription factor MYB36
TrEMBLB8LKH90.0B8LKH9_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-76myb domain protein 36